Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX16 Peptide - middle region

PEX16 Peptide - middle region

Product Specifications

Product Name Alternative

PBD8A, PBD8B

UniProt

Q9Y5Y5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Immunoglobulin A
TRP-00517-01 10 mg

Human Immunoglobulin A

Sign In for Pricing
View Details
Human Immunoglobulin A
TRP-00517-02 50 mg

Human Immunoglobulin A

Sign In for Pricing
View Details
FITC Anti-Mouse CD162 Antibody
RD30156F-01 25 µg

FITC Anti-Mouse CD162 Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD162 Antibody
RD30156F-02 100 µg

FITC Anti-Mouse CD162 Antibody

Sign In for Pricing
View Details
BTNL8, ID (BTNL8, Butyrophilin-like protein 8) (MaxLight 650) discontinued
032625-ML650 100 µL

BTNL8, ID (BTNL8, Butyrophilin-like protein 8) (MaxLight 650) discontinued

Sign In for Pricing
View Details
MAPK11 Rabbit Polyclonal Antibody (Fluoro550)
orb3107206 100 µg

MAPK11 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details