Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX16 Peptide - middle region

PEX16 Peptide - middle region

Product Specifications

Product Name Alternative

PBD8A, PBD8B

UniProt

Q9Y5Y5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSR

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL39 Antibody
E19-4175 100 µg -100 µL

MRPL39 Antibody

Sign In for Pricing
View Details
Pressinoic Acid
E-PP-1803-01 10 mg

Pressinoic Acid

Sign In for Pricing
View Details
Pressinoic Acid
E-PP-1803-02 100 mg

Pressinoic Acid

Sign In for Pricing
View Details
Pressinoic Acid
E-PP-1803-03 5 mg

Pressinoic Acid

Sign In for Pricing
View Details
Anti-mtTFA Rabbit Monoclonal Antibody
M01119-2-100μl 100 µL

Anti-mtTFA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FANCD2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61302R-BF555-TR 20 µL

FANCD2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details