What is the catalog number for MED8 Peptide - middle region?

The catalog number for MED8 Peptide - middle region is orb1998891.

What sizes are available for MED8 Peptide - middle region?

MED8 Peptide - middle region is available in the following size(s): 100 µg.

Is MED8 Peptide - middle region in stock?

MED8 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MED8 Peptide - middle region

Product Specifications

Product Name Alternative

ARC32

UniProt

Q96G25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001653.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-527773 1 Kit

FNBP2 (G-10) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing

View Details

orb2546983 100 µL

Sidekick 1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing

View Details

bsm-62583R-BF555 100 µL

UFM1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing

View Details

orb147280 100 µg

HSP40 Antibody (FITC)

Sign In for Pricing

View Details

PVT37989 2 µg

pExpress-1-Maob Plasmid

Sign In for Pricing

View Details

BNUB0313-500 1x 500 µL

CD45 / LCA (Leucocyte Marker) (Bra55), 0.2mg/mL

Sign In for Pricing

View Details