MED8 Peptide - middle region
MED8 Peptide - middle region
Product Specifications
Product Name Alternative
ARC32
UniProt
Q96G25
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001001653.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTIL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
104010G0-AAT 100 Tests
IFluor® 660 Anti-human CD40 Antibody *G28.5*
Sign In for Pricing
View Details bsm-61525R-BF405-01 20 µL
PDK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
Sign In for Pricing
View Details bsm-61525R-BF405-02 100 µL
PDK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
Sign In for Pricing
View Details 
CSB-EP358618MVH-01 10 µg
Recombinant Mycobacterium bovis O-acetylserine sulfhydrylase (cysK)
Sign In for Pricing
View Details CSB-EP358618MVH-02 50 µg
Recombinant Mycobacterium bovis O-acetylserine sulfhydrylase (cysK)
Sign In for Pricing
View Details