Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB1 Peptide - middle region

TUBB1 Peptide - middle region

Product Specifications

UniProt

Q9H4B7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_110400.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRPLL (HNRNPLL) (NM_138394) Human Tagged ORF Clone
RG203569 10 µg

HNRPLL (HNRNPLL) (NM_138394) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cytochalasin D
B1176-5 5 mg

Cytochalasin D

Sign In for Pricing
View Details
PBF Lentiviral Activation Particles (h2)
sc-407913-LAC-2 200 µL

PBF Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Involucrin Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61489R-BF350-TR 20 µL

Involucrin Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Precemtabart Human Monoclonal Antibody
orb2976162-01 100 µg

Precemtabart Human Monoclonal Antibody

Sign In for Pricing
View Details
Precemtabart Human Monoclonal Antibody
orb2976162-02 1 mg

Precemtabart Human Monoclonal Antibody

Sign In for Pricing
View Details