Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB1 Peptide - middle region

TUBB1 Peptide - middle region

Product Specifications

UniProt

Q9H4B7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_110400.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX25 Antibody
56-297 400 µL

SNX25 Antibody

Sign In for Pricing
View Details
Human ARSF ELISA Kit (Ready to Use)
orb549911-01 48 Tests

Human ARSF ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human ARSF ELISA Kit (Ready to Use)
orb549911-02 96 Tests

Human ARSF ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
SPAG5 Peptide - middle region (AAP75371)
AAP75371-100UG 100 µg

SPAG5 Peptide - middle region (AAP75371)

Sign In for Pricing
View Details
Rabbit Polyclonal ZMYM6 Antibody [Janelia Fluor 525]
NBP3-26106JF525 0.1 mL

Rabbit Polyclonal ZMYM6 Antibody [Janelia Fluor 525]

Sign In for Pricing
View Details
anti-CIAS1 / NALP3
YF-PA26812 50 ul

anti-CIAS1 / NALP3

Sign In for Pricing
View Details