Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A20 Peptide - C-terminal region

SLC6A20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

XT3, SIT1, Xtrp3

UniProt

Q9NP91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_064593.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQGQLVTKDYPAYALAVIGLLVASSTMCIPLAALGTFVQRRLKRGDADPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Depdc5 Mouse Gene Knockout Kit (CRISPR)
KN304504 1 Kit

Depdc5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD7/GP40 Protein (Fc Tag)
PKSH033512-01 10 µg

Recombinant Human CD7/GP40 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD7/GP40 Protein (Fc Tag)
PKSH033512-02 50 µg

Recombinant Human CD7/GP40 Protein (Fc Tag)

Sign In for Pricing
View Details
CNTF Receptor alpha (CNTFR) Human Gene Knockout Kit (CRISPR)
KN400487 1 Kit

CNTF Receptor alpha (CNTFR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD81 Antibody[1.3.3.22]
E-AB-F1073L-01 20 Tests

Elab Fluor® 488 Anti-Human CD81 Antibody[1.3.3.22]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD81 Antibody[1.3.3.22]
E-AB-F1073L-02 100 Tests

Elab Fluor® 488 Anti-Human CD81 Antibody[1.3.3.22]

Sign In for Pricing
View Details