Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A20 Peptide - C-terminal region

SLC6A20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

XT3, SIT1, Xtrp3

UniProt

Q9NP91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_064593.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQGQLVTKDYPAYALAVIGLLVASSTMCIPLAALGTFVQRRLKRGDADPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SOX10 Antibody
RC-3096-01 50 μL

Recombinant SOX10 Antibody

Sign In for Pricing
View Details
Recombinant SOX10 Antibody
RC-3096-02 100 µL

Recombinant SOX10 Antibody

Sign In for Pricing
View Details
Recombinant SOX10 Antibody
RC-3096-03 1 mL

Recombinant SOX10 Antibody

Sign In for Pricing
View Details
rac-Nicotine-d4
TRC-N412427-2.5MG 2.5 mg

rac-Nicotine-d4

Sign In for Pricing
View Details
C3orf56 Human Gene Knockout Kit (CRISPR)
KN418176 1 Kit

C3orf56 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human KIAA1755 activation kit by CRISPRa
GA113889 1 Kit

Human KIAA1755 activation kit by CRISPRa

Sign In for Pricing
View Details