Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CANX Peptide - middle region

CANX Peptide - middle region

Product Specifications

Product Name Alternative

CNX, P90, IP90

UniProt

P27824

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019820.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351C-01 50 Tests

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351C-02 100 Tests

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351C-03 2x 100 Tests

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit
E-CL-H0902-01 24 Tests

Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit

Sign In for Pricing
View Details
Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit
E-CL-H0902-02 48 Tests

Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit

Sign In for Pricing
View Details
Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit
E-CL-H0902-03 96 Tests

Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit

Sign In for Pricing
View Details