Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CANX Peptide - middle region

CANX Peptide - middle region

Product Specifications

Product Name Alternative

CNX, P90, IP90

UniProt

P27824

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019820.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF568 conjugate, 0.1mg/mL
BNC682259-100 1x 100 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-alpha-Tocotrienol (Rice) (>75%)
TRC-T526203-10MG 10 mg

D-alpha-Tocotrienol (Rice) (>75%)

Sign In for Pricing
View Details
Canine Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit
RD-CD40L-c-01 96 Tests

Canine Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit

Sign In for Pricing
View Details
Canine Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit
RD-CD40L-c-02 48 Tests

Canine Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit

Sign In for Pricing
View Details
IL17B Mouse Monoclonal Antibody [Clone ID: OTI3F7]
CF811132 100 µg

IL17B Mouse Monoclonal Antibody [Clone ID: OTI3F7]

Sign In for Pricing
View Details
Perfluorodecalin
TRC-P286240-50G 50 g

Perfluorodecalin

Sign In for Pricing
View Details