Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBR1 Peptide - middle region

DBR1 Peptide - middle region

Product Specifications

UniProt

Q9UK59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057300.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSALSSINPDEIML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC15A1 Antibody
orb1250369 0.05 mg

SLC15A1 Antibody

Sign In for Pricing
View Details
DDO (D-Aspartate Oxidase, DASOX, FLJ45203) (AP) discontinued
125713-AP 100 µL

DDO (D-Aspartate Oxidase, DASOX, FLJ45203) (AP) discontinued

Sign In for Pricing
View Details
ACVRL1 (Serine/threonine-Protein Kinase Receptor R3, SKR3, Activin Receptor-like Kinase 1, ALK-1, TGF-B Superfamily Receptor Type I, TSR-I, ACVRL1, ACVRLK1, ALK1) discontinued
220580-01 50 µL

ACVRL1 (Serine/threonine-Protein Kinase Receptor R3, SKR3, Activin Receptor-like Kinase 1, ALK-1, TGF-B Superfamily Receptor Type I, TSR-I, ACVRL1, ACVRLK1, ALK1) discontinued

Sign In for Pricing
View Details
ACVRL1 (Serine/threonine-Protein Kinase Receptor R3, SKR3, Activin Receptor-like Kinase 1, ALK-1, TGF-B Superfamily Receptor Type I, TSR-I, ACVRL1, ACVRLK1, ALK1) discontinued
220580-02 100 µL

ACVRL1 (Serine/threonine-Protein Kinase Receptor R3, SKR3, Activin Receptor-like Kinase 1, ALK-1, TGF-B Superfamily Receptor Type I, TSR-I, ACVRL1, ACVRLK1, ALK1) discontinued

Sign In for Pricing
View Details
Interleukin 6 (IL-6) (PE)
MBS6482753-01 0.1 mL

Interleukin 6 (IL-6) (PE)

Sign In for Pricing
View Details
Interleukin 6 (IL-6) (PE)
MBS6482753-02 5x 0.1 mL

Interleukin 6 (IL-6) (PE)

Sign In for Pricing
View Details