Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBR1 Peptide - middle region

DBR1 Peptide - middle region

Product Specifications

UniProt

Q9UK59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057300.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSALSSINPDEIML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC6A Rabbit pAb
orb2711994-01 50 µL

TRAPPC6A Rabbit pAb

Sign In for Pricing
View Details
TRAPPC6A Rabbit pAb
orb2711994-02 100 µL

TRAPPC6A Rabbit pAb

Sign In for Pricing
View Details
SLC23A3 Polyclonal Antibody
E-AB-91016-01 60 µL

SLC23A3 Polyclonal Antibody

Sign In for Pricing
View Details
SLC23A3 Polyclonal Antibody
E-AB-91016-02 120 µL

SLC23A3 Polyclonal Antibody

Sign In for Pricing
View Details
SLC23A3 Polyclonal Antibody
E-AB-91016-03 200 µL

SLC23A3 Polyclonal Antibody

Sign In for Pricing
View Details
rno??miR-339-5p miRNA Antagomir
MNR01487 2x 5.0 nmol

rno??miR-339-5p miRNA Antagomir

Sign In for Pricing
View Details