IMPA2 Peptide - C-terminal region
IMPA2 Peptide - C-terminal region
Product Specifications
UniProt
O14732
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_055029.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
352522 100 µg
SKI2W, NT (Superkiller viralicidic activity 2-like, DDX13, Helicase-like protein, Helicase SKI2W, HLP, SKI2, SKIV2, SKIV2L)
Sign In for Pricing
View Details 
EK0800-carrier-free 96 Well With Removable Strips
Mouse IL-27/IL-30 p28 ELISA Kit PicoKine®, Carrier-free
Sign In for Pricing
View Details