What is the catalog number for IMPA2 Peptide - C-terminal region?

The catalog number for IMPA2 Peptide - C-terminal region is orb1998881.

What sizes are available for IMPA2 Peptide - C-terminal region?

IMPA2 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is IMPA2 Peptide - C-terminal region in stock?

IMPA2 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IMPA2 Peptide - C-terminal region

Product Specifications

UniProt

O14732

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055029.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CM-0119B 4x 125 mL

HuH-6 (William's E) Cell Complete Medium

Sign In for Pricing

View Details

EKU05270 96 Tests

Guinea pig Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing

View Details

A05609-1-Dylight594 100 µg

Anti-JunD Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing

View Details

32-4428-50 50 µg

Recombinant Human Phosphatidylethanolamine Binding Protein 1

Sign In for Pricing

View Details

RP022561 100 µg

PARD6B Recombinant Protein (Human)

Sign In for Pricing

View Details

A19676-100UG 100 µg

DNAL4 Antibody, HRP conjugated

Sign In for Pricing

View Details