Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKN2 Peptide - middle region

PKN2 Peptide - middle region

Product Specifications

Product Name Alternative

PAK2, PRK2, STK7, Pak-2, PRKCL2, PRO2042

UniProt

Q16513

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006247.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OXM Porcine Protein
OPPA01056-10UG 10 µg

OXM Porcine Protein

Sign In for Pricing
View Details
LAMA4 Antibody
MBS9415133-01 0.1 mL

LAMA4 Antibody

Sign In for Pricing
View Details
LAMA4 Antibody
MBS9415133-02 5x 0.1 mL

LAMA4 Antibody

Sign In for Pricing
View Details
Human Transcription factor p65 ELISA Kit
EK2040 Inquire

Human Transcription factor p65 ELISA Kit

Sign In for Pricing
View Details
Rchy1 Rat shRNA Plasmid (Locus ID 289508)
TL700808 1 Kit

Rchy1 Rat shRNA Plasmid (Locus ID 289508)

Sign In for Pricing
View Details
7-APRA
OR1037858-01 25 g

7-APRA

Sign In for Pricing
View Details