PKN2 Peptide - middle region
PKN2 Peptide - middle region
Product Specifications
Product Name Alternative
PAK2, PRK2, STK7, Pak-2, PRKCL2, PRO2042
UniProt
Q16513
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_006247.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AE12308MO-01 48 Tests
Mouse Mitochondrial brown fat uncoupling protein 1 (UCP1) ELISA Kit
Sign In for Pricing
View Details AE12308MO-02 96 Tests
Mouse Mitochondrial brown fat uncoupling protein 1 (UCP1) ELISA Kit
Sign In for Pricing
View Details 
GTR15307090 1 Vial
Lentiviral human SERPINB8 shRNA (UAS) - Lentiviral human SERPINB8 shRNA (UAS) plasmid
Sign In for Pricing
View Details 
AK0403-100T-48S 100 Tests - 48 Samples
Acid Phosphatase (ACP) Activity Assay Kit
Sign In for Pricing
View Details