Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR3 Peptide - N-terminal region

PLSCR3 Peptide - N-terminal region

Product Specifications

UniProt

Q9NRY6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001188505.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat FN (Fibronectin) ELISA Kit
E-EL-R0578-01 24 Tests

Rat FN (Fibronectin) ELISA Kit

Sign In for Pricing
View Details
Rat FN (Fibronectin) ELISA Kit
E-EL-R0578-02 48 Tests

Rat FN (Fibronectin) ELISA Kit

Sign In for Pricing
View Details
Rat FN (Fibronectin) ELISA Kit
E-EL-R0578-03 96 Tests

Rat FN (Fibronectin) ELISA Kit

Sign In for Pricing
View Details
3-O-Alpha-D-Glucopyranosyl-D-fructose
TRC-G423500-5G 5 g

3-O-Alpha-D-Glucopyranosyl-D-fructose

Sign In for Pricing
View Details
Cyclin G (CCNG1) (NM_199246) Human Over-expression Lysate
LC404314 20 µg

Cyclin G (CCNG1) (NM_199246) Human Over-expression Lysate

Sign In for Pricing
View Details
Myotilin (MYOT) Mouse Monoclonal Antibody [Clone ID: OTI5E11]
CF809575 100 µg

Myotilin (MYOT) Mouse Monoclonal Antibody [Clone ID: OTI5E11]

Sign In for Pricing
View Details