Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR3 Peptide - N-terminal region

PLSCR3 Peptide - N-terminal region

Product Specifications

UniProt

Q9NRY6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001188505.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Amino-2-thiouracil Hydrate
TRC-A630455-25G 25 g

6-Amino-2-thiouracil Hydrate

Sign In for Pricing
View Details
CD82 (C-term) Rabbit Polyclonal Antibody
AP23396PU-N 100 µg

CD82 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TPMT (NM_000367) Human Over-expression Lysate
LC400131 20 µg

TPMT (NM_000367) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Stratifin (SFN) ELISA Kit
RDR-SFN-Hu-01 96 Tests

Human Stratifin (SFN) ELISA Kit

Sign In for Pricing
View Details
Human Stratifin (SFN) ELISA Kit
RDR-SFN-Hu-02 48 Tests

Human Stratifin (SFN) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lymph node
CB515673 1 Block

Frozen Tissue Blocks, Lymph node

Sign In for Pricing
View Details