Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHI3L2 Peptide - middle region

CHI3L2 Peptide - middle region

Product Specifications

Product Name Alternative

CHIL2, YKL39, YKL-39

UniProt

Q15782

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001020368.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF405S conjugate, 0.1mg/mL
BNC042564-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RK 33
TRC-R545500-2.5MG 2.5 mg

RK 33

Sign In for Pricing
View Details
Human KIAA1984 (CCDC183) activation kit by CRISPRa
GA113802 1 Kit

Human KIAA1984 (CCDC183) activation kit by CRISPRa

Sign In for Pricing
View Details
Gpx4 (BC106147) Mouse Tagged ORF Clone
MG201418 10 µg

Gpx4 (BC106147) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: transverse
CS506139 5x 5 µm

Frozen Tissue Sections, Colon: transverse

Sign In for Pricing
View Details
OR2J2 Antibody
8G553-AAT 50 µg

OR2J2 Antibody

Sign In for Pricing
View Details