Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHI3L2 Peptide - middle region

CHI3L2 Peptide - middle region

Product Specifications

Product Name Alternative

CHIL2, YKL39, YKL-39

UniProt

Q15782

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001020368.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP2c (TFCP2) Rabbit Polyclonal Antibody
TA365690 100 µL

CP2c (TFCP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prolactin (PRL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9D12]
TA500718BM 100 µL

Prolactin (PRL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9D12]

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF640R conjugate, 0.1mg/mL
BNC400904-100 1x 100 µL

CD34 (QBEnd/10 + HPCA1/763), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
7-Propyltryptophol
TRC-P894750-250MG 250 mg

7-Propyltryptophol

Sign In for Pricing
View Details
Recombinant CD276 Antibody
RC-16675-01 50 μL

Recombinant CD276 Antibody

Sign In for Pricing
View Details
Recombinant CD276 Antibody
RC-16675-02 100 µL

Recombinant CD276 Antibody

Sign In for Pricing
View Details