SPG21 Peptide - N-terminal region
SPG21 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MAST, ACP33, GL010, BM-019
UniProt
Q9NZD8
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001121361.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQIL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6326287-01 0.1 mL
NPM3, NT (NPM3, Nucleoplasmin-3) (MaxLight 490)
Sign In for Pricing
View Details MBS6326287-02 5x 0.1 mL
NPM3, NT (NPM3, Nucleoplasmin-3) (MaxLight 490)
Sign In for Pricing
View Details orb1298227-01 100 mg
N-Chloroacetyl-3,5-bis (trifluoromethyl) aniline
Sign In for Pricing
View Details orb1298227-02 1 ml x 10 mM (in DMSO)
N-Chloroacetyl-3,5-bis (trifluoromethyl) aniline
Sign In for Pricing
View Details 