Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPG21 Peptide - N-terminal region

SPG21 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAST, ACP33, GL010, BM-019

UniProt

Q9NZD8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001121361.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr214 (m) -PR
sc-150688-PR 10 µM - 20 µL

Olfr214 (m) -PR

Sign In for Pricing
View Details
Recombinant Human CDC25A
MBS7613396-01 0.05 mg

Recombinant Human CDC25A

Sign In for Pricing
View Details
Recombinant Human CDC25A
MBS7613396-02 0.2 mg

Recombinant Human CDC25A

Sign In for Pricing
View Details
Recombinant Human CDC25A
MBS7613396-03 1 mg

Recombinant Human CDC25A

Sign In for Pricing
View Details
Recombinant Human CDC25A
MBS7613396-04 5x 1 mg

Recombinant Human CDC25A

Sign In for Pricing
View Details
AKR1CL2 (aldo-keto Reductase Family 1, Member C-like 2, AKRDC1, LoopADR, MGC10612) (PE)
243212-PE 100 µL

AKR1CL2 (aldo-keto Reductase Family 1, Member C-like 2, AKRDC1, LoopADR, MGC10612) (PE)

Sign In for Pricing
View Details