What is the catalog number for PLEK Peptide - C-terminal region?

The catalog number for PLEK Peptide - C-terminal region is orb1998870.

What sizes are available for PLEK Peptide - C-terminal region?

PLEK Peptide - C-terminal region is available in the following size(s): 100 µg.

Is PLEK Peptide - C-terminal region in stock?

PLEK Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PLEK Peptide - C-terminal region

Product Specifications

Product Name Alternative

P47

UniProt

P08567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002655.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBA46774-01 250 mg

1-[3-Methoxy-4- (methylsulfanyl) phenyl]ethan-1-one

Sign In for Pricing

View Details

HBA46774-02 2.5 g

1-[3-Methoxy-4- (methylsulfanyl) phenyl]ethan-1-one

Sign In for Pricing

View Details

C10499 25 mg

TriacetonaMine

Sign In for Pricing

View Details

M01513-7-20μl 20 µL

Anti-CD31 Rabbit Monoclonal Antibody

Sign In for Pricing

View Details

21470141 1x 10^6 Cells / 1.0 mL

GGH CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing

View Details

FC07-500ug 500 µg

Recombinant Human IgG2 Fc (Glu99-Lys326, Val161Met)

Sign In for Pricing

View Details