Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEK Peptide - C-terminal region

PLEK Peptide - C-terminal region

Product Specifications

Product Name Alternative

P47

UniProt

P08567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002655.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Uroplakin 3A (UPK3A) ELISA Kit
DL-UPK3A-Hu-01 48 Tests

Human Uroplakin 3A (UPK3A) ELISA Kit

Sign In for Pricing
View Details
Human Uroplakin 3A (UPK3A) ELISA Kit
DL-UPK3A-Hu-02 96 Tests

Human Uroplakin 3A (UPK3A) ELISA Kit

Sign In for Pricing
View Details
Plant Chloroplast Membrane Protein Extraction Kit-Enzymatic method
EX1340-01 50 Tests

Plant Chloroplast Membrane Protein Extraction Kit-Enzymatic method

Sign In for Pricing
View Details
Plant Chloroplast Membrane Protein Extraction Kit-Enzymatic method
EX1340-02 100 Tests

Plant Chloroplast Membrane Protein Extraction Kit-Enzymatic method

Sign In for Pricing
View Details
SCF (Stem Cell Factor) Porcine ELISA Kit
G9032 96 Tests

SCF (Stem Cell Factor) Porcine ELISA Kit

Sign In for Pricing
View Details
HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF640R conjugate, 0.1mg/mL
BNC403066-500 1x 500 µL

HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details