TPP2 Peptide - middle region
TPP2 Peptide - middle region
Product Specifications
Product Name Alternative
TPP-2, TPPII
UniProt
P29144
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003282.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YYLIPPPTKTKNGSKDKEKDSEKEKDLKEEFTEALRDLKIQWMTKLDSSD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2145540-01 0.1 mL
Cy3-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)
Sign In for Pricing
View Details MBS2145540-02 0.2 mL
Cy3-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)
Sign In for Pricing
View Details MBS2145540-03 0.5 mL
Cy3-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)
Sign In for Pricing
View Details MBS2145540-04 1 mL
Cy3-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)
Sign In for Pricing
View Details MBS2145540-05 5 mL
Cy3-Linked Monoclonal Antibody to Inulin Like Growth Factor Binding Protein 1 (IGFBP1)
Sign In for Pricing
View Details