What is the catalog number for MTPAP Peptide - middle region?

The catalog number for MTPAP Peptide - middle region is orb1998868.

What sizes are available for MTPAP Peptide - middle region?

MTPAP Peptide - middle region is available in the following size(s): 100 µg.

Is MTPAP Peptide - middle region in stock?

MTPAP Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MTPAP Peptide - middle region

Product Specifications

Product Name Alternative

PAPD1, SPAX4

UniProt

Q9NVV4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060579.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP002092 100 µg

ASNSD1 Recombinant Protein (Human)

Sign In for Pricing

View Details

NBP2-70079IR 0.1 mL

Mouse Monoclonal Activin RIIA Antibody (OTI5D1) [DyLight 755]

Sign In for Pricing

View Details

508774 100 µg

DIXDC1 (CCD1, KIAA1735) discontinued

Sign In for Pricing

View Details

VAng-Yyj4240-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Gilvum mshB Protein (aa 1-284)

Sign In for Pricing

View Details

NBP2-89826F 0.1 mL

Rabbit Monoclonal Nicastrin Antibody (004) [FITC]

Sign In for Pricing

View Details

21177024 500 ng

GADD45GIP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing

View Details