Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTPAP Peptide - middle region

MTPAP Peptide - middle region

Product Specifications

Product Name Alternative

PAPD1, SPAX4

UniProt

Q9NVV4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060579.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRMD7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0814306 1.0 µg DNA

FRMD7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
C17orf57 ORF Vector (Human) (pORF)
ORF016471 1.0 µg DNA

C17orf57 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal CtBP1 Antibody (4D6) [Janelia Fluor 646]
NBP1-74040JF646 0.1 mL

Mouse Monoclonal CtBP1 Antibody (4D6) [Janelia Fluor 646]

Sign In for Pricing
View Details
CDKN2A Antibody
A16871-100UL 100 µL

CDKN2A Antibody

Sign In for Pricing
View Details
MOBKL2B Rabbit Polyclonal Antibody (RBITC)
orb1039260 100 µL

MOBKL2B Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Goat Cytovillin ELISA Kit
GTR10479099-01 48 Well

Goat Cytovillin ELISA Kit

Sign In for Pricing
View Details