Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TULP3 Peptide - middle region

TULP3 Peptide - middle region

Product Specifications

Product Name Alternative

TUBL3

UniProt

O75386

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syt6 (NM_018800) Mouse Tagged ORF Clone
MG216780 10 µg

Syt6 (NM_018800) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Cox7a2 activation kit by CRISPRa
GA200845 1 Kit

Mouse Cox7a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to DLL4
sAP-0736 50 µg

Mouse Monoclonal Antibody to DLL4

Sign In for Pricing
View Details
Heating block, used for 50 mL tubes, 8 holes
HB-E120 1 Each

Heating block, used for 50 mL tubes, 8 holes

Sign In for Pricing
View Details
IL23A Protein Lysate
OCOA02327-20UG 20 µg

IL23A Protein Lysate

Sign In for Pricing
View Details
Mouse Monoclonal Cystatin C Antibody (Cyst13) [Janelia Fluor 585]
NBP1-05763JF585 0.2 mL

Mouse Monoclonal Cystatin C Antibody (Cyst13) [Janelia Fluor 585]

Sign In for Pricing
View Details