Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TULP3 Peptide - middle region

TULP3 Peptide - middle region

Product Specifications

Product Name Alternative

TUBL3

UniProt

O75386

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morc2b Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
30313064 1.0 µg DNA

Morc2b Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
BMS1P5 CRISPR Knock Out 293T Cell Line (Human)
13385141 1x 10^6 Cells / 1.0 mL

BMS1P5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
hsa-miR-4666b Primers
MPH02844 150 µL - 10 µM

hsa-miR-4666b Primers

Sign In for Pricing
View Details
SUMF2 siRNA (Human)
orb1859705-01 15 nmol

SUMF2 siRNA (Human)

Sign In for Pricing
View Details
SUMF2 siRNA (Human)
orb1859705-02 30 nmol

SUMF2 siRNA (Human)

Sign In for Pricing
View Details
PC Cell-derived Growth Factor (PCDGF)
P9182-35B 100 µg

PC Cell-derived Growth Factor (PCDGF)

Sign In for Pricing
View Details