What is the catalog number for IMP4 Peptide - C-terminal region?

The catalog number for IMP4 Peptide - C-terminal region is orb1998864.

What sizes are available for IMP4 Peptide - C-terminal region?

IMP4 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is IMP4 Peptide - C-terminal region in stock?

IMP4 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IMP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BXDC4

UniProt

Q96G21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_219484.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTARKRVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMM12820V 100 µL

Estrogen Related Receptor gamma (ESRRG) Mouse Monoclonal Antibody [Clone ID: LBI1D10]

Sign In for Pricing

View Details

IRBAMLSARS1AP332120UL 1 Each

Rabbit Anti SARS1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence)

Sign In for Pricing

View Details

SI018668B 1 Each

Human ZNF195 Pre-designed siRNA Set B

Sign In for Pricing

View Details

554870-01 50 µg

ALDH1A3 (Biotin)

Sign In for Pricing

View Details

554870-02 100 µg

ALDH1A3 (Biotin)

Sign In for Pricing

View Details

MBS1027679-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Phosphoglycerate kinase (pgk)

Sign In for Pricing

View Details