What is the catalog number for IMP4 Peptide - C-terminal region?

The catalog number for IMP4 Peptide - C-terminal region is orb1998864.

What sizes are available for IMP4 Peptide - C-terminal region?

IMP4 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is IMP4 Peptide - C-terminal region in stock?

IMP4 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IMP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BXDC4

UniProt

Q96G21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_219484.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTARKRVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

043074-Biotin 200 µL

TNFRSF14, ID (TNFRSF14, HVEA, HVEM, Tumor necrosis factor receptor superfamily member 14, Herpes virus entry mediator A, Tumor necrosis factor receptor-like 2, CD270) (Biotin) discontinued

Sign In for Pricing

View Details

50756166 1.0 µg

Zcchc11 AAV siRNA Pooled Vector

Sign In for Pricing

View Details

SI212006A 1 Each

Rat Rnf133 Pre-designed siRNA Set A

Sign In for Pricing

View Details

M16324 100 µL

Anti-CXorf26 (PBDC1) Mouse Monoclonal Antibody [Clone ID: OTI5A11]

Sign In for Pricing

View Details

OACA08754-100UL 100 µL

DCTN3 Antibody

Sign In for Pricing

View Details

SR419918 1 Kit

Cfb Mouse siRNA Oligo Duplex (Locus ID 14962)

Sign In for Pricing

View Details