What is the catalog number for STX7 Peptide - middle region?

The catalog number for STX7 Peptide - middle region is orb1998859.

What sizes are available for STX7 Peptide - middle region?

STX7 Peptide - middle region is available in the following size(s): 100 µg.

Is STX7 Peptide - middle region in stock?

STX7 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

STX7 Peptide - middle region

Product Specifications

UniProt

O15400

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003560.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC202054 10 µg

Cav1 (NM_007616) Mouse Untagged Clone

Sign In for Pricing

View Details

sc-478067A 10 mg

(R) -N'-Nitrosonornicotine-d4

Sign In for Pricing

View Details

A54253-050 50 µL

MB Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing

View Details

PH31886E1 50 µg

FOXR2 (NM_198451) Human Recombinant Protein

Sign In for Pricing

View Details

MBS1305363-01 0.02 mg (E-Coli)

Recombinant Vibrio parahaemolyticus UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing

View Details

MBS1305363-02 0.02 mg (Yeast)

Recombinant Vibrio parahaemolyticus UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing

View Details