Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIP4 Peptide - middle region

TRIP4 Peptide - middle region

Product Specifications

Product Name Alternative

ASC1, ASC-1, ZC2HC5, HsT17391

UniProt

Q15650

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057297.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECM2 (NM_001393) Human Tagged ORF Clone
RC217806 10 µg

ECM2 (NM_001393) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rat Intercellular adhesion molecule 1 ELISA Kit
EK1116 Inquire

Rat Intercellular adhesion molecule 1 ELISA Kit

Sign In for Pricing
View Details
LTB4-R2 Rabbit Polyclonal Antibody
orb6336-01 50 μL

LTB4-R2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LTB4-R2 Rabbit Polyclonal Antibody
orb6336-02 100 µL

LTB4-R2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LTB4-R2 Rabbit Polyclonal Antibody
orb6336-03 200 µL

LTB4-R2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF253 shRNA Plasmid
abx961109-01 150 µg

Human ZNF253 shRNA Plasmid

Sign In for Pricing
View Details