What is the catalog number for TRIP4 Peptide - middle region?

The catalog number for TRIP4 Peptide - middle region is orb1998858.

What sizes are available for TRIP4 Peptide - middle region?

TRIP4 Peptide - middle region is available in the following size(s): 100 µg.

Is TRIP4 Peptide - middle region in stock?

TRIP4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TRIP4 Peptide - middle region

Product Specifications

Product Name Alternative

ASC1, ASC-1, ZC2HC5, HsT17391

UniProt

Q15650

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057297.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-418863-ACT-2 20 µg

BBIP1 CRISPR Activation Plasmid (h2)

Sign In for Pricing

View Details

46861171 3x 5 nmol

TMEM106B siRNA Oligos set (Human)

Sign In for Pricing

View Details

IHUMANSC1RC6HISLY50UG 50 µg

Human MANSC1 Recombinant Protein C-6 His Tag Lyophilized 50UG

Sign In for Pricing

View Details

PV055581 500 ng

NOP2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing

View Details

16377174 3x 5 nmol

Clpx siRNA Oligos set (Mouse)

Sign In for Pricing

View Details

ARG36099 1 Million

IL3 Knockout Hela Polyclonal Cells

Sign In for Pricing

View Details