Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNASE1L1 Peptide - middle region

DNASE1L1 Peptide - middle region

Product Specifications

Product Name Alternative

XIB, G4.8, DNL1L, DNASEX, DNAS1L1

UniProt

P49184

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009932.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEVVDSSGSAIPLLLRELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS636443 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
KDM4E Human Gene Knockout Kit (CRISPR)
KN428936 1 Kit

KDM4E Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AIF (AIFM1) Rabbit Monoclonal Antibody
TA422200 100 µL

AIF (AIFM1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560176 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF594 conjugate, 0.1mg/mL
BNC943792-100 1x 100 µL

Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SYPL2 (NM_001040709) Human Over-expression Lysate
LC420833 20 µg

SYPL2 (NM_001040709) Human Over-expression Lysate

Sign In for Pricing
View Details