HSPA14 Peptide - C-terminal region
HSPA14 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HSP70-4, HSP70L1
UniProt
Q0VDF9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_057383.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDIL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC231392L3V 200 µL
NASP (NM_001195193) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details orb2998819-01 48 Tests
Human CCR6 (Chemokine C-C-Motif Receptor 6) Microsample ELISA Kit
Sign In for Pricing
View Details orb2998819-02 96 Tests
Human CCR6 (Chemokine C-C-Motif Receptor 6) Microsample ELISA Kit
Sign In for Pricing
View Details 
A03092-2-Fluoro550 100 µg/Vial
Anti-PDGFC Antibody Picoband® Fluoro550 Conjugated
Sign In for Pricing
View Details