What is the catalog number for PNRC1 Peptide - middle region?

The catalog number for PNRC1 Peptide - middle region is orb1998853.

What sizes are available for PNRC1 Peptide - middle region?

PNRC1 Peptide - middle region is available in the following size(s): 100 µg.

Is PNRC1 Peptide - middle region in stock?

PNRC1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PNRC1 Peptide - middle region

Product Specifications

Product Name Alternative

B4-2, PRR2, PROL2, PNAS-145

UniProt

Q12796

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E16FHO034-100 100 Tests

APC-Cy7 anti-human CD34

Sign In for Pricing

View Details

43783064 1.0 µg DNA

SIK2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

K1233301 3x 1.0 µg

LRRC17 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing

View Details

orb706350-01 1 mg

CD39 Blocking Peptide

Sign In for Pricing

View Details

orb706350-02 5 mg

CD39 Blocking Peptide

Sign In for Pricing

View Details

LKU604127 96 Tests

Androstenediol (AED) Magnetic Luminex Assay Kit

Sign In for Pricing

View Details