Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBA7 Peptide - middle region

UBA7 Peptide - middle region

Product Specifications

Product Name Alternative

D8, UBE2, UBA1B, UBE1L

UniProt

P41226

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003326.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TBC1D15 activation kit by CRISPRa
GA112147 1 Kit

Human TBC1D15 activation kit by CRISPRa

Sign In for Pricing
View Details
CD105 Rabbit Polyclonal Antibody
HA500266 100 µL

CD105 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ICE2 Polyclonal Antibody
E-AB-90519-01 60 µL

ICE2 Polyclonal Antibody

Sign In for Pricing
View Details
ICE2 Polyclonal Antibody
E-AB-90519-02 120 µL

ICE2 Polyclonal Antibody

Sign In for Pricing
View Details
ICE2 Polyclonal Antibody
E-AB-90519-03 200 µL

ICE2 Polyclonal Antibody

Sign In for Pricing
View Details
Human Retinoic Acid Inducible Gene 1 Protein (RIG1) ELISA Kit
RDR-RIG1-Hu-01 96 Tests

Human Retinoic Acid Inducible Gene 1 Protein (RIG1) ELISA Kit

Sign In for Pricing
View Details