Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL22 Peptide - C-terminal region

KLHL22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KELCHL

UniProt

Q53GT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_116164.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEGPQLDNSISGLAACVLTLPRSLLLEPPRGTPDRSQADPDFASEVMSVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferric Chloride Solution 10% (Gerhardt's Reagent)
834320-01 125 mL

Ferric Chloride Solution 10% (Gerhardt's Reagent)

Sign In for Pricing
View Details
Ferric Chloride Solution 10% (Gerhardt's Reagent)
834320-02 1 L

Ferric Chloride Solution 10% (Gerhardt's Reagent)

Sign In for Pricing
View Details
Pitpna (NM_017231) Rat Untagged Clone
RN214809 10 µg

Pitpna (NM_017231) Rat Untagged Clone

Sign In for Pricing
View Details
Klrb1 (NM_001099918) Mouse Tagged ORF Clone
MR222421 10 µg

Klrb1 (NM_001099918) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
L-Argininamide dihydrochloride
T4023-01 50 mg

L-Argininamide dihydrochloride

Sign In for Pricing
View Details
L-Argininamide dihydrochloride
T4023-02 1 mL - 10 mM (in DMSO)

L-Argininamide dihydrochloride

Sign In for Pricing
View Details