Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL22 Peptide - C-terminal region

KLHL22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KELCHL

UniProt

Q53GT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_116164.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEGPQLDNSISGLAACVLTLPRSLLLEPPRGTPDRSQADPDFASEVMSVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHCHD2 Rabbit pAb, Pacific Blue conjugated
orb2888697 100 µL

CHCHD2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
TMBIM1 Protein Vector (Human) (pPM-C-His)
PV042336 500 ng

TMBIM1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
FGF2 Polyclonal Antibody, Cy3 Conjugated
bs-0217R-Cy3-01 20 µL

FGF2 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
FGF2 Polyclonal Antibody, Cy3 Conjugated
bs-0217R-Cy3-02 100 µL

FGF2 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]
CF503099 100 µg

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]

Sign In for Pricing
View Details
Anti-IL-1 beta/IL1B Antibody Picoband® (APC Conjugate)
A00101-APC 100 µg/Vial

Anti-IL-1 beta/IL1B Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details