Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR7 Peptide - N-terminal region

MTMR7 Peptide - N-terminal region

Product Specifications

UniProt

Q9Y216

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004677.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horseradish Peroxidase Conjugated Rabbit Polyclonal Antibody to Canine IgG
PA-2353-1 1 mL

Horseradish Peroxidase Conjugated Rabbit Polyclonal Antibody to Canine IgG

Sign In for Pricing
View Details
2-Phenyl Alpha-Cortolone 1,3-Dioxane
TRC-P319330-5MG 5 mg

2-Phenyl Alpha-Cortolone 1,3-Dioxane

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB610554 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
CACNA2D1 (NM_000722) Human Over-expression Lysate
LC424551 20 µg

CACNA2D1 (NM_000722) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Amino-4-chloropyridine
TRC-A603512-25G 25 g

2-Amino-4-chloropyridine

Sign In for Pricing
View Details
Human GODZ (ZDHHC3) activation kit by CRISPRa
GA109723 1 Kit

Human GODZ (ZDHHC3) activation kit by CRISPRa

Sign In for Pricing
View Details