Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR7 Peptide - N-terminal region

MTMR7 Peptide - N-terminal region

Product Specifications

UniProt

Q9Y216

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004677.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cecum
CS701803 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details
Human CISD3 activation kit by CRISPRa
GA117096 1 Kit

Human CISD3 activation kit by CRISPRa

Sign In for Pricing
View Details
LRATD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F12]
TA501993BM 100 µL

LRATD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F12]

Sign In for Pricing
View Details
OPA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G3]
TA809469AM 100 µL

OPA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS644463 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
S100B (4C4.9 + S100B/1012), 0.2mg/mL
BNCB1204-100 1x 100 µL

S100B (4C4.9 + S100B/1012), 0.2mg/mL

Sign In for Pricing
View Details