Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOZ3 Peptide - middle region

MYOZ3 Peptide - middle region

Product Specifications

Product Name Alternative

CS3, CS-3, FRP3

UniProt

Q8TDC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116325.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin, alpha skeletal muscle Monoclonal Antibody, PerCP Conjugated
bsm-33308M-PerCP-TR 20 µL

Actin, alpha skeletal muscle Monoclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Dlec1 3'UTR Luciferase Stable Cell Line
TU203441 1.0 mL

Dlec1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
3-(quinoxalin-2-yl)prop-2-enoic Acid
TRC-E592440-50MG 50 mg

3-(quinoxalin-2-yl)prop-2-enoic Acid

Sign In for Pricing
View Details
Label/Dot Combo Roll, Cryo, Direct Thermal
LTC-38X13-95Y 500/Box

Label/Dot Combo Roll, Cryo, Direct Thermal

Sign In for Pricing
View Details
NL7541A4YL-3 Die-cut & Printed Numbers & Letters
911299 1 Piece (1 Panel (s) x 1 Pack)

NL7541A4YL-3 Die-cut & Printed Numbers & Letters

Sign In for Pricing
View Details
TIMP1 Antibody
orb671746-01 50 µg

TIMP1 Antibody

Sign In for Pricing
View Details