Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOZ3 Peptide - middle region

MYOZ3 Peptide - middle region

Product Specifications

Product Name Alternative

CS3, CS-3, FRP3

UniProt

Q8TDC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116325.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Fam172a antibody - N-terminal region
APR00716G 0.05mg

Polyclonal Fam172a antibody - N-terminal region

Sign In for Pricing
View Details
Recombinant Mouse SIRPA
Pr22955-01 10 µg

Recombinant Mouse SIRPA

Sign In for Pricing
View Details
Recombinant Mouse SIRPA
Pr22955-02 50 µg

Recombinant Mouse SIRPA

Sign In for Pricing
View Details
Recombinant Mouse SIRPA
Pr22955-03 500 µg

Recombinant Mouse SIRPA

Sign In for Pricing
View Details
Recombinant Mouse SIRPA
Pr22955-04 1 mg

Recombinant Mouse SIRPA

Sign In for Pricing
View Details
Anti-Human CA9 Antibody (SAA0475), APC
FHH37223 100 Tests

Anti-Human CA9 Antibody (SAA0475), APC

Sign In for Pricing
View Details