Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35A5 Peptide - C-terminal region

SLC35A5 Peptide - C-terminal region

Product Specifications

UniProt

Q9BS91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060415.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NASKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Rabbit IgG Coated - 96 well Solid plates - Black PS
MCB26F-aR/W 10x 96 Well Plates

Goat anti-Rabbit IgG Coated - 96 well Solid plates - Black PS

Sign In for Pricing
View Details
ERI2 Protein Lysate (Mouse) with C-HA Tag
19426034 100 µg

ERI2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
LOC201725 Blocking Peptide
33R-9811 100 ug

LOC201725 Blocking Peptide

Sign In for Pricing
View Details
GSTT1 (N-term) Rabbit Polyclonal Antibody
E10G32645 100 µL

GSTT1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC42BPA Polyclonal Antibody
MBS2559669-01 0.02 mL

CDC42BPA Polyclonal Antibody

Sign In for Pricing
View Details
CDC42BPA Polyclonal Antibody
MBS2559669-02 0.06 mL

CDC42BPA Polyclonal Antibody

Sign In for Pricing
View Details