SLC35A5 Peptide - C-terminal region
SLC35A5 Peptide - C-terminal region
Product Specifications
UniProt
Q9BS91
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060415.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NASKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-ALT-Hu-96Tests 96 Tests
Human Alanine Aminotransferase (ALT) ELISA Kit
Sign In for Pricing
View Details 
abx500908 96 Tests
Human Beta-actin-like protein 2 (ACTBL2) ELISA Kit
Sign In for Pricing
View Details C2421-01C 100 µg
CD66b (CEACAM-8, CEA-related cell adhesion molecule 8, CGM6, CEA gene family member 6, NCA-95, Nonspecific crossreacting antigen 95) (BSA & Azide Free)
Sign In for Pricing
View Details