TTC17 Peptide - N-terminal region
TTC17 Peptide - N-terminal region
Product Specifications
UniProt
Q96AE7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060729.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MRQEATVNYLKELEKQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15305981 1 Vial
Lentiviral mouse Rhox6 shRNA (UAS) - Lentiviral mouse Rhox6 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 
428118 100 mg
(3S) -1,2,3,4-Tetrahydro-6,7-dimethoxy-3-isoquinolinecarboxylic Acid
Sign In for Pricing
View Details 
MBS1490710-01 0.05 mg
Rabbit anti-chicken Collagen alpha-1(XII) chain polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details