Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPC Peptide - C-terminal region

CENPC Peptide - C-terminal region

Product Specifications

Product Name Alternative

MIF2, hcp-4, CENP-C, CENPC1

UniProt

Q03188

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001803.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF740 conjugate, 0.1mg/mL
BNC741859-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLHL3 (NM_017415) Human Recombinant Protein
TP318393L 1 mg

KLHL3 (NM_017415) Human Recombinant Protein

Sign In for Pricing
View Details
Human ZNF780A activation kit by CRISPRa
GA117120 1 Kit

Human ZNF780A activation kit by CRISPRa

Sign In for Pricing
View Details
MyoD1 (5.8A), CF594 conjugate, 0.1mg/mL
BNC940191-500 1x 500 µL

MyoD1 (5.8A), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FANCF Polyclonal Antibody
E-AB-15015-01 20 µL

FANCF Polyclonal Antibody

Sign In for Pricing
View Details
FANCF Polyclonal Antibody
E-AB-15015-02 60 µL

FANCF Polyclonal Antibody

Sign In for Pricing
View Details