Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPC Peptide - C-terminal region

CENPC Peptide - C-terminal region

Product Specifications

Product Name Alternative

MIF2, hcp-4, CENP-C, CENPC1

UniProt

Q03188

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001803.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD22 Mouse Monoclonal Antibody [Clone ID: B-ly8]
AM39016RP-N 100 Tests

CD22 Mouse Monoclonal Antibody [Clone ID: B-ly8]

Sign In for Pricing
View Details
MEX3A Antibody
KC-8460-01 50 μL

MEX3A Antibody

Sign In for Pricing
View Details
MEX3A Antibody
KC-8460-02 100 µL

MEX3A Antibody

Sign In for Pricing
View Details
MEX3A Antibody
KC-8460-03 1 mL

MEX3A Antibody

Sign In for Pricing
View Details
2-Nitrobenzotrifluoride
TRC-N495018-50MG 50 mg

2-Nitrobenzotrifluoride

Sign In for Pricing
View Details
Bisphenol AP-13C6
TRC-B519487-1MG 1 mg

Bisphenol AP-13C6

Sign In for Pricing
View Details