Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GID8 Peptide - C-terminal region

GID8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TWA1, C20orf11

UniProt

Q9NWU2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060366.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK5/p35, GST-tag
40095 10 µg

CDK5/p35, GST-tag

Sign In for Pricing
View Details
CCT6P4 Protein Vector (Human) (pPB-N-His)
PV068134 500 ng

CCT6P4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
MIR614 ORF Vector (Human) (pORF)
ORF024958 1.0 µg DNA

MIR614 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-6/CD327 Antibody (767329) [mFluor Violet 610 SE]
FAB2859MFV610 0.1 mL

Mouse Monoclonal Siglec-6/CD327 Antibody (767329) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Lentiviral human FBXO39 shRNA (UAS) - Lentiviral human FBXO39 shRNA (UAS, iRFP) plasmid
GTR15114664 1 Vial

Lentiviral human FBXO39 shRNA (UAS) - Lentiviral human FBXO39 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Chloroacetaldehyde Sodium Bisulfite
TRC-C382483-250MG 250 mg

Chloroacetaldehyde Sodium Bisulfite

Sign In for Pricing
View Details